Logo Search packages:      
Sourcecode: python-biopython version File versions

test_IsoelectricPoint.py

from Bio.SeqUtils import IsoelectricPoint, ProtParam

X = ProtParam.ProteinAnalysis("MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTSGLLYGSQTPSEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV")
print "isoelectric point for this protein: %.3f" % X.isoelectric_point()

Generated by  Doxygen 1.6.0   Back to index