Logo Search packages:      
Sourcecode: python-biopython version File versions  Download package

test_NCBIXML.py

# Copyright 2005 by Michiel de Hoon.  All rights reserved.
# This code is part of the Biopython distribution and governed by its
# license.  Please see the LICENSE file that should have been included
# as part of this package.

import os
import unittest
from Bio.Blast import NCBIXML

E_VALUE_THRESH = 1e-10

00012 class TestNCBIXML(unittest.TestCase):

    def test_xbt001(self):
        "Parsing BLASTP 2.2.12, gi|49176427|ref|NP_418280.3|"

        filename = 'xbt001.xml'
        datafile = os.path.join("Blast", filename)
        records = NCBIXML.parse(open(datafile))
        record = records.next()

        alignments = record.alignments
        self.assertEqual(len(alignments), 212)
        self.assertEqual(record.query_id, "gi|49176427|ref|NP_418280.3|")
        self.assertEqual(sum([len(a.hsps) for a in alignments]), 212)

        alignment = alignments[0]
        self.assertEqual(alignment.title[:50], "gi|49176427|ref|NP_418280.3| component of Sec-inde")
        self.assertEqual(alignment.length, 103)
        self.assertEqual(len(alignment.hsps), 1)
        hsp = alignment.hsps[0]
        self.assert_(hsp.expect, 4.20576e-46)
        self.assertEqual(hsp.query[:75], "MRLCLIIIYHRGTCMGGISIWQXXXXXXXXXXXFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTA")
        self.assertEqual(hsp.match[:75], "MRLCLIIIYHRGTCMGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTA")
        self.assertEqual(hsp.sbjct[:75], "MRLCLIIIYHRGTCMGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTA")

        alignment = alignments[1]
        self.assertEqual(alignment.title[:50], "gi|15804428|ref|NP_290468.1| twin arginine translo")
        self.assertEqual(alignment.length, 103)
        self.assertEqual(len(alignment.hsps), 1)
        hsp = alignment.hsps[0]
        self.assert_(hsp.expect, 2.72609e-45)
        self.assertEqual(hsp.query[:75], "MRLCLIIIYHRGTCMGGISIWQXXXXXXXXXXXFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTA")
        self.assertEqual(hsp.match[:75], "MRLCLIIIYHR TCMGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTA")
        self.assertEqual(hsp.sbjct[:75], "MRLCLIIIYHRXTCMGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTA")

        alignment = alignments[2]
        self.assertEqual(alignment.title[:50], "gi|74314349|ref|YP_312768.1| hypothetical protein ")
        self.assertEqual(alignment.length, 103)
        self.assertEqual(len(alignment.hsps), 1)
        hsp = alignment.hsps[0]
        self.assert_(hsp.expect, 2.72609e-45)
        self.assertEqual(hsp.query[:75], "MRLCLIIIYHRGTCMGGISIWQXXXXXXXXXXXFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTA")
        self.assertEqual(hsp.match[:75], "MR CLIIIYHRGTCMGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTA")
        self.assertEqual(hsp.sbjct[:75], "MRPCLIIIYHRGTCMGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTA")

        alignment = alignments[3]
        self.assertEqual(alignment.title[:50], "gi|75256240|ref|ZP_00727918.1| COG1826: Sec-indepe")
        self.assertEqual(alignment.length, 89)
        self.assertEqual(len(alignment.hsps), 1)
        hsp = alignment.hsps[0]
        self.assert_(hsp.expect, 6.0872e-37)
        self.assertEqual(hsp.query[:75], "MGGISIWQXXXXXXXXXXXFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQ")
        self.assertEqual(hsp.match[:75], "MGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQ")
        self.assertEqual(hsp.sbjct[:75], "MGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQ")

        alignment = alignments[4]
        self.assertEqual(alignment.title[:50], "gi|148236|gb|AAA67633.1| o261 [Escherichia coli]")
        self.assertEqual(alignment.length, 261)
        self.assertEqual(len(alignment.hsps), 1)
        hsp = alignment.hsps[0]
        self.assert_(hsp.expect, 6.74582e-28)
        self.assertEqual(hsp.query[:75], "FGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQAKTEDA")
        self.assertEqual(hsp.match[:75], "FGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQAKTEDA")
        self.assertEqual(hsp.sbjct[:75], "FGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQAKTEDA")

        alignment = alignments[5]
        self.assertEqual(alignment.title[:50], "gi|29143650|ref|NP_806992.1| sec-independent prote")
        self.assertEqual(alignment.length, 84)
        self.assertEqual(len(alignment.hsps), 1)
        hsp = alignment.hsps[0]
        self.assert_(hsp.expect, 4.37251e-27)
        self.assertEqual(hsp.query[:75], "MGGISIWQXXXXXXXXXXXFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQ")
        self.assertEqual(hsp.match[:75], "MGGISIWQLLI+AVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDD+ KQDKTSQDADFTAK+IADKQ      +")
        self.assertEqual(hsp.sbjct[:75], "MGGISIWQLLIVAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDDAKQDKTSQDADFTAKSIADKQG-----E")

        alignment = alignments[6]
        self.assertEqual(alignment.title[:50], "gi|49609685|emb|CAG73118.1| sec-independent protei")
        self.assertEqual(alignment.length, 86)
        self.assertEqual(len(alignment.hsps), 1)
        hsp = alignment.hsps[0]
        self.assert_(hsp.expect, 4.10205e-17)
        self.assertEqual(hsp.query[:75], "MGGISIWQXXXXXXXXXXXFGTKKLGSIGSDLGASIKGFKKAMSDDEP--KQDKTSQDADFTAKTIADKQADTNQ")
        self.assertEqual(hsp.match[:75], "MGGIS+W LLIIAVIV+LLFGT KL ++GSDLGASIKGFKKAM DD+P    DK   DADF+ K+IAD Q+D   ")
        self.assertEqual(hsp.sbjct[:75], "MGGISLWNLLIIAVIVILLFGTNKLRTLGSDLGASIKGFKKAMGDDQPSTNADKAQPDADFSTKSIADNQSD---")

        alignment = alignments[7]
        self.assertEqual(alignment.title[:50], "gi|37528238|ref|NP_931583.1| Sec-independent prote")
        self.assertEqual(alignment.length, 86)
        self.assertEqual(len(alignment.hsps), 1)
        hsp = alignment.hsps[0]
        self.assert_(hsp.expect, 2.25087e-15)
        self.assertEqual(hsp.query[:75], "MGGISIWQXXXXXXXXXXXFGTKKLGSIGSDLGASIKGFKKAMSDD-EPKQ-DKTSQDADFTAKTIADKQADTNQ")
        self.assertEqual(hsp.match[:75], "MGGISIWQLLIIAVIVVLLFGT KL ++GSDLGASIKGFKKA+ DD +P+Q  KTS DADF  K I +KQ+    ")
        self.assertEqual(hsp.sbjct[:75], "MGGISIWQLLIIAVIVVLLFGTNKLRTLGSDLGASIKGFKKAIGDDNQPQQAQKTSSDADFETKNITEKQS----")

        alignment = alignments[8]
        self.assertEqual(alignment.title[:50], "gi|59710656|ref|YP_203432.1| Sec-independent prote")
        self.assertEqual(alignment.length, 82)
        self.assertEqual(len(alignment.hsps), 1)
        hsp = alignment.hsps[0]
        self.assert_(hsp.expect, 5.01441e-15)
        self.assertEqual(hsp.query[:75], "MGGISIWQXXXXXXXXXXXFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQ")
        self.assertEqual(hsp.match[:75], "MGGISIWQLLIIAVI+VLLFGTKKL  +GSDLG+++KGFKKA+S+DEP ++   +DADF  + +  K+A+T ++Q")
        self.assertEqual(hsp.sbjct[:75], "MGGISIWQLLIIAVIIVLLFGTKKLRGVGSDLGSAVKGFKKAISEDEPAKE-AKKDADFVPQNLEKKEAETVEKQ")

        alignment = alignments[9]
        self.assertEqual(alignment.title[:50], "gi|54307340|ref|YP_128360.1| putative TatA protein")
        self.assertEqual(alignment.length, 87)
        self.assertEqual(len(alignment.hsps), 1)
        hsp = alignment.hsps[0]
        self.assert_(hsp.expect, 7.2408e-14)
        self.assertEqual(hsp.query[:75], "MGGISIWQXXXXXXXXXXXFGTKKLGSIGSDLGASIKGFKKAMSDDE--PKQDKTSQDADFTAKTIADKQADTNQ")
        self.assertEqual(hsp.match[:75], "MGGISIWQLLIIA+I+VLLFGTKKL S+G DLG+++KGFKKA+ D+E   K+D T  DADF  KT++ ++  +  ")
        self.assertEqual(hsp.sbjct[:75], "MGGISIWQLLIIALIIVLLFGTKKLRSLGGDLGSAVKGFKKAIGDEELTVKKDNTEADADFEQKTLSKEEQQSED")

        alignment = alignments[10]
        self.assertEqual(alignment.title[:50], "gi|45437890|gb|AAS63439.1| Sec-independent protein")
        self.assertEqual(alignment.length, 88)
        self.assertEqual(len(alignment.hsps), 1)
        hsp = alignment.hsps[0]
        self.assert_(hsp.expect, 1.61308e-13)
        self.assertEqual(hsp.query[:75], "MGGISIWQXXXXXXXXXXXFGTKKLGSIGSDLGASIKGFKKAMSDDE----PKQDKTSQDADFTAKTIADKQADT")
        self.assertEqual(hsp.match[:75], "MG I   QLLIIAVIVVLLFGT KL ++GSDLGASIKGFKKAM DD        DKTS DADF AK+I +KQ   ")
        self.assertEqual(hsp.sbjct[:75], "MGSIGWAQLLIIAVIVVLLFGTNKLRTLGSDLGASIKGFKKAMGDDSQTPPTNVDKTSNDADF-AKSITEKQ---")

        alignment = alignments[11]
        self.assertEqual(alignment.title[:50], "gi|75856473|ref|ZP_00764101.1| COG1826: Sec-indepe")
        self.assertEqual(alignment.length, 81)
        self.assertEqual(len(alignment.hsps), 1)
        hsp = alignment.hsps[0]
        self.assert_(hsp.expect, 2.10675e-13)
        self.assertEqual(hsp.query[:75], "MGGISIWQXXXXXXXXXXXFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQ")
        self.assertEqual(hsp.match[:75], "MGGIS+WQLLIIAVIVVLLFGTKKL  IG DLG ++KGFKKAMS+DEP   K  +DADF  K++ ++Q    +++")
        self.assertEqual(hsp.sbjct[:75], "MGGISVWQLLIIAVIVVLLFGTKKLRGIGGDLGGAVKGFKKAMSEDEPA--KNDKDADFEPKSLEEQQ----KKE")

        alignment = alignments[12]
        self.assertEqual(alignment.title[:50], "gi|75829371|ref|ZP_00758676.1| COG1826: Sec-indepe")
        self.assertEqual(alignment.length, 82)
        self.assertEqual(len(alignment.hsps), 1)
        hsp = alignment.hsps[0]
        self.assert_(hsp.expect, 2.7515e-13)
        self.assertEqual(hsp.query[:75], "MGGISIWQXXXXXXXXXXXFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQ")
        self.assertEqual(hsp.match[:75], "MGGISIWQLLIIAVIVVLLFGTKKL  IGSDLG+++KGFKKAMS++E       +DADF  K         N EQ")
        self.assertEqual(hsp.sbjct[:75], "MGGISIWQLLIIAVIVVLLFGTKKLRGIGSDLGSAVKGFKKAMSEEESNSAANQKDADFETK---------NLEQ")

        alignment = alignments[13]
        self.assertEqual(alignment.title[:50], "gi|75820019|ref|ZP_00750077.1| COG1826: Sec-indepe")
        self.assertEqual(alignment.length, 82)
        self.assertEqual(len(alignment.hsps), 1)
        hsp = alignment.hsps[0]
        self.assert_(hsp.expect, 3.59357e-13)
        self.assertEqual(hsp.query[:75], "MGGISIWQXXXXXXXXXXXFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQ")
        self.assertEqual(hsp.match[:75], "MGGISIWQLLIIAVIVVLLFGTKKL  IGSDLG+++KGFKKAMS++E       +DADF  K         N EQ")
        self.assertEqual(hsp.sbjct[:75], "MGGISIWQLLIIAVIVVLLFGTKKLRGIGSDLGSAVKGFKKAMSEEESNSAANQKDADFETK---------NLEQ")

        alignment = alignments[14]
        self.assertEqual(alignment.title[:50], "gi|28896872|ref|NP_796477.1| TatA protein [Vibrio ")
        self.assertEqual(alignment.length, 81)
        self.assertEqual(len(alignment.hsps), 1)
        hsp = alignment.hsps[0]
        self.assert_(hsp.expect, 2.32928e-12)
        self.assertEqual(hsp.query[:75], "MGGISIWQXXXXXXXXXXXFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQ")
        self.assertEqual(hsp.match[:75], "MGGIS+WQLLIIAVIVVLLFGTKKL  IG DLG+++KGFKKAMSD++    K  +DADF  K++  +Q    Q++")
        self.assertEqual(hsp.sbjct[:75], "MGGISVWQLLIIAVIVVLLFGTKKLRGIGGDLGSAVKGFKKAMSDED--SAKNEKDADFEPKSLEKQQ----QKE")

        alignment = alignments[15]
        self.assertEqual(alignment.title[:50], "gi|27364353|ref|NP_759881.1| Sec-independent prote")
        self.assertEqual(alignment.length, 78)
        self.assertEqual(len(alignment.hsps), 1)
        hsp = alignment.hsps[0]
        self.assert_(hsp.expect, 3.97316e-12)
        self.assertEqual(hsp.query[:75], "MGGISIWQXXXXXXXXXXXFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQ")
        self.assertEqual(hsp.match[:75], "MGGISIWQLLIIAVIVVLLFGTKKL  IGSDLG +IKGFKKAM+++E ++    +DADF  K++     +   +Q")
        self.assertEqual(hsp.sbjct[:75], "MGGISIWQLLIIAVIVVLLFGTKKLRGIGSDLGGAIKGFKKAMNEEESEK----KDADFEPKSL-----EQQSKQ")

        alignment = alignments[16]
        self.assertEqual(alignment.title[:50], "gi|37678364|ref|NP_932973.1| Sec-independent prote")
        self.assertEqual(alignment.length, 78)
        self.assertEqual(len(alignment.hsps), 1)
        hsp = alignment.hsps[0]
        self.assert_(hsp.expect, 3.97316e-12)
        self.assertEqual(hsp.query[:75], "MGGISIWQXXXXXXXXXXXFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQ")
        self.assertEqual(hsp.match[:75], "MGGISIWQLLIIAVIVVLLFGTKKL  IGSDLG +IKGFKKAM+++E ++    +DADF  K++     +   +Q")
        self.assertEqual(hsp.sbjct[:75], "MGGISIWQLLIIAVIVVLLFGTKKLRGIGSDLGGAIKGFKKAMNEEESEK----KDADFEPKSL-----EQQNKQ")

        alignment = alignments[17]
        self.assertEqual(alignment.title[:50], "gi|71277787|ref|YP_266931.1| Sec-independent prote")
        self.assertEqual(alignment.length, 85)
        self.assertEqual(len(alignment.hsps), 1)
        hsp = alignment.hsps[0]
        self.assert_(hsp.expect, 3.97316e-12)
        self.assertEqual(hsp.query[:75], "MGGISIWQXXXXXXXXXXXFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQ")
        self.assertEqual(hsp.match[:75], "MGGI IWQL+I+AVIVVLLFGTKKL +IG DLG++IKGFK A+ +D  K+ K S  A+ T+ T+AD    T +E ")
        self.assertEqual(hsp.sbjct[:75], "MGGIGIWQLVIVAVIVVLLFGTKKLRNIGGDLGSAIKGFKSAIGED--KEQKNS--AEKTSDTLADSSKSTTEEV")

        alignment = alignments[18]
        self.assertEqual(alignment.title[:50], "gi|68541995|ref|ZP_00581733.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 79)
        self.assertEqual(len(alignment.hsps), 1)
        hsp = alignment.hsps[0]
        self.assert_(hsp.expect, 2.57533e-11)
        self.assertEqual(hsp.query[:75], "MGGISIWQXXXXXXXXXXXFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKT---IADKQADTN")
        self.assertEqual(hsp.match[:75], "MGGISIWQLLI+A+IVVLLFGTKKL S+G DLG ++KGFK AMS +E K+     +A  TA+T     +K+ ++N")
        self.assertEqual(hsp.sbjct[:75], "MGGISIWQLLIVALIVVLLFGTKKLRSLGGDLGGAVKGFKNAMSSEEDKKALEDTEAAKTAQTTQQATEKKPESN")

        alignment = alignments[19]
        self.assertEqual(alignment.title[:50], "gi|77813363|ref|ZP_00812641.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 79)
        self.assertEqual(len(alignment.hsps), 1)
        hsp = alignment.hsps[0]
        self.assert_(hsp.expect, 2.57533e-11)
        self.assertEqual(hsp.query[:75], "MGGISIWQXXXXXXXXXXXFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKT---IADKQADTN")
        self.assertEqual(hsp.match[:75], "MGGISIWQLLIIA+IVVLLFGTKKL S+G DLG ++KGFK AMS +E K+     +A  TA+T     +K+ ++N")
        self.assertEqual(hsp.sbjct[:75], "MGGISIWQLLIIALIVVLLFGTKKLRSLGGDLGGAVKGFKNAMSSEEDKKALEDTEAAKTAQTTQQATEKKPESN")

        alignment = alignments[20]
        self.assertEqual(alignment.title[:50], "gi|52306607|gb|AAU37107.1| TatA protein [Mannheimi")
        self.assertEqual(alignment.length, 75)
        self.assertEqual(len(alignment.hsps), 1)
        hsp = alignment.hsps[0]
        self.assert_(hsp.expect, 3.36348e-11)
        self.assertEqual(hsp.query[:75], "MGGISIWQXXXXXXXXXXXFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQ")
        self.assertEqual(hsp.match[:75], "MGGISIWQLLII  I+VLLFGTKKL ++G+DLG S+KGFKKAM++DEPK      DA+F +    D+ A    E+")
        self.assertEqual(hsp.sbjct[:75], "MGGISIWQLLIIVAIIVLLFGTKKLRTLGTDLGESVKGFKKAMNEDEPK------DAEFKSLN-KDESATAGSEK")

        alignment = alignments[21]
        self.assertEqual(alignment.title[:50], "gi|75429751|ref|ZP_00732413.1| sec-independent pro")
        self.assertEqual(alignment.length, 74)
        self.assertEqual(len(alignment.hsps), 1)
        hsp = alignment.hsps[0]
        self.assert_(hsp.expect, 3.36348e-11)
        self.assertEqual(hsp.query[:75], "MGGISIWQXXXXXXXXXXXFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQ")
        self.assertEqual(hsp.match[:75], "MGGISIWQLLII  IVVLLFGTKKL ++GSDLG S+KGFKKAM+ +EPK      DA+F +   A+  A T +E+")
        self.assertEqual(hsp.sbjct[:75], "MGGISIWQLLIIVAIVVLLFGTKKLRTLGSDLGESVKGFKKAMA-EEPK------DAEFKSLDKAENTAQTKKEE")

        alignment = alignments[22]
        self.assertEqual(alignment.title[:50], "gi|32033565|ref|ZP_00133892.1| COG1826: Sec-indepe")
        self.assertEqual(alignment.length, 76)
        self.assertEqual(len(alignment.hsps), 1)
        hsp = alignment.hsps[0]
        self.assert_(hsp.expect, 7.49305e-11)
        self.assertEqual(hsp.query[:75], "MGGISIWQXXXXXXXXXXXFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQ")
        self.assertEqual(hsp.match[:75], "MGGISIWQLLII  I+VLLFGTKKL ++G+DLG S+KGFKKAM+DD+      SQ  D + + +  K+A + +++")
        self.assertEqual(hsp.sbjct[:75], "MGGISIWQLLIIVAIIVLLFGTKKLRTLGTDLGESVKGFKKAMADDK------SQPQDASFEKVEAKEAASTEQK")

        alignment = alignments[23]
        self.assertEqual(alignment.title[:50], "gi|12722097|gb|AAK03773.1| unknown [Pasteurella mu")
        self.assertEqual(alignment.length, 76)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[24]
        self.assertEqual(alignment.title[:50], "gi|68546478|ref|ZP_00586025.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 77)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[25]
        self.assertEqual(alignment.title[:50], "gi|33151888|ref|NP_873241.1| sec-independent prote")
        self.assertEqual(alignment.length, 74)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[26]
        self.assertEqual(alignment.title[:50], "gi|24375687|ref|NP_719730.1| Sec-independent prote")
        self.assertEqual(alignment.length, 88)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[27]
        self.assertEqual(alignment.title[:50], "gi|71278553|ref|YP_269744.1| Sec-independent prote")
        self.assertEqual(alignment.length, 79)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[28]
        self.assertEqual(alignment.title[:50], "gi|69159855|gb|EAN71956.1| Twin-arginine transloca")
        self.assertEqual(alignment.length, 79)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[29]
        self.assertEqual(alignment.title[:50], "gi|69949858|ref|ZP_00637822.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 81)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[30]
        self.assertEqual(alignment.title[:50], "gi|48863844|ref|ZP_00317737.1| hypothetical protei")
        self.assertEqual(alignment.length, 83)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[31]
        self.assertEqual(alignment.title[:50], "gi|77361831|ref|YP_341406.1| twin-arginine translo")
        self.assertEqual(alignment.length, 82)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[32]
        self.assertEqual(alignment.title[:50], "gi|67676224|ref|ZP_00472975.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 90)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[33]
        self.assertEqual(alignment.title[:50], "gi|74317722|ref|YP_315462.1| twin-arginine translo")
        self.assertEqual(alignment.length, 70)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[34]
        self.assertEqual(alignment.title[:50], "gi|77166504|ref|YP_345029.1| Twin-arginine translo")
        self.assertEqual(alignment.length, 90)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[35]
        self.assertEqual(alignment.title[:50], "gi|16128610|ref|NP_415160.1| component of Sec-inde")
        self.assertEqual(alignment.length, 67)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[36]
        self.assertEqual(alignment.title[:50], "gi|12831974|emb|CAC29147.1| TatA protein [Pseudomo")
        self.assertEqual(alignment.length, 76)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[37]
        self.assertEqual(alignment.title[:50], "gi|32029972|ref|ZP_00132908.1| COG1826: Sec-indepe")
        self.assertEqual(alignment.length, 73)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[38]
        self.assertEqual(alignment.title[:50], "gi|455172|gb|AAA24073.1| ORF; putative")
        self.assertEqual(alignment.length, 67)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[39]
        self.assertEqual(alignment.title[:50], "gi|1224007|gb|AAA92108.1| ORF4")
        self.assertEqual(alignment.length, 192)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[40]
        self.assertEqual(alignment.title[:50], "gi|68056990|gb|AAX87243.1| Sec-independent protein")
        self.assertEqual(alignment.length, 95)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[41]
        self.assertEqual(alignment.title[:50], "gi|56461470|ref|YP_156751.1| Sec-independent prote")
        self.assertEqual(alignment.length, 73)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[42]
        self.assertEqual(alignment.title[:50], "gi|76793313|ref|ZP_00775802.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 84)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[43]
        self.assertEqual(alignment.title[:50], "gi|42630489|ref|ZP_00156028.1| COG1826: Sec-indepe")
        self.assertEqual(alignment.length, 75)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[44]
        self.assertEqual(alignment.title[:50], "gi|1074302|pir||B64145 hypothetical protein HI0187")
        self.assertEqual(alignment.length, 109)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[45]
        self.assertEqual(alignment.title[:50], "gi|67641583|ref|ZP_00440359.1| COG1826: Sec-indepe")
        self.assertEqual(alignment.length, 77)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[46]
        self.assertEqual(alignment.title[:50], "gi|67545726|ref|ZP_00423646.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 76)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[47]
        self.assertEqual(alignment.title[:50], "gi|45435806|gb|AAS61363.1| sec-independent protein")
        self.assertEqual(alignment.length, 85)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[48]
        self.assertEqual(alignment.title[:50], "gi|49610761|emb|CAG74206.1| Sec-independent protei")
        self.assertEqual(alignment.length, 65)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[49]
        self.assertEqual(alignment.title[:50], "gi|67663266|ref|ZP_00460549.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 76)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[50]
        self.assertEqual(alignment.title[:50], "gi|33594634|ref|NP_882278.1| Sec-independent prote")
        self.assertEqual(alignment.length, 75)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[51]
        self.assertEqual(alignment.title[:50], "gi|46310681|ref|ZP_00211309.1| COG1826: Sec-indepe")
        self.assertEqual(alignment.length, 76)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[52]
        self.assertEqual(alignment.title[:50], "gi|58584031|ref|YP_203047.1| sec-independent prote")
        self.assertEqual(alignment.length, 75)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[53]
        self.assertEqual(alignment.title[:50], "gi|17429965|emb|CAD16649.1| PROBABLE SIGNAL PEPTID")
        self.assertEqual(alignment.length, 85)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[54]
        self.assertEqual(alignment.title[:50], "gi|47573371|ref|ZP_00243410.1| COG1826: Sec-indepe")
        self.assertEqual(alignment.length, 76)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[55]
        self.assertEqual(alignment.title[:50], "gi|16273687|ref|NP_438355.1| Sec-independent prote")
        self.assertEqual(alignment.length, 89)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[56]
        self.assertEqual(alignment.title[:50], "gi|73542784|ref|YP_297304.1| Twin-arginine translo")
        self.assertEqual(alignment.length, 73)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[57]
        self.assertEqual(alignment.title[:50], "gi|26987777|ref|NP_743202.1| Sec-independent prote")
        self.assertEqual(alignment.length, 77)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[58]
        self.assertEqual(alignment.title[:50], "gi|29142636|ref|NP_805978.1| sec-independent prote")
        self.assertEqual(alignment.length, 67)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[59]
        self.assertEqual(alignment.title[:50], "gi|18389921|gb|AAL68797.1| TatA [Ralstonia eutroph")
        self.assertEqual(alignment.length, 77)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[60]
        self.assertEqual(alignment.title[:50], "gi|48781637|ref|ZP_00278228.1| COG1826: Sec-indepe")
        self.assertEqual(alignment.length, 79)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[61]
        self.assertEqual(alignment.title[:50], "gi|77456610|ref|YP_346115.1| Twin-arginine translo")
        self.assertEqual(alignment.length, 92)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[62]
        self.assertEqual(alignment.title[:50], "gi|1684735|emb|CAA98158.1| ORF57 protein [Pseudomo")
        self.assertEqual(alignment.length, 57)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[63]
        self.assertEqual(alignment.title[:50], "gi|56476124|ref|YP_157713.1| Sec-independent prote")
        self.assertEqual(alignment.length, 75)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[64]
        self.assertEqual(alignment.title[:50], "gi|34496078|ref|NP_900293.1| Sec-independent prote")
        self.assertEqual(alignment.length, 68)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[65]
        self.assertEqual(alignment.title[:50], "gi|67848115|ref|ZP_00503233.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 83)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[66]
        self.assertEqual(alignment.title[:50], "gi|26991692|ref|NP_747117.1| Sec-independent prote")
        self.assertEqual(alignment.length, 90)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[67]
        self.assertEqual(alignment.title[:50], "gi|15601293|ref|NP_232924.1| tatA protein [Vibrio ")
        self.assertEqual(alignment.length, 78)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[68]
        self.assertEqual(alignment.title[:50], "gi|66770480|ref|YP_245242.1| sec-independent prote")
        self.assertEqual(alignment.length, 75)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[69]
        self.assertEqual(alignment.title[:50], "gi|53804435|ref|YP_113945.1| Sec-independent prote")
        self.assertEqual(alignment.length, 70)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[70]
        self.assertEqual(alignment.title[:50], "gi|75825357|ref|ZP_00754793.1| COG1826: Sec-indepe")
        self.assertEqual(alignment.length, 80)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[71]
        self.assertEqual(alignment.title[:50], "gi|71908987|ref|YP_286574.1| Twin-arginine translo")
        self.assertEqual(alignment.length, 76)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[72]
        self.assertEqual(alignment.title[:50], "gi|68526571|gb|EAN49542.1| Twin-arginine transloca")
        self.assertEqual(alignment.length, 77)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[73]
        self.assertEqual(alignment.title[:50], "gi|71736448|ref|YP_272670.1| sec-independent prote")
        self.assertEqual(alignment.length, 91)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[74]
        self.assertEqual(alignment.title[:50], "gi|56460344|ref|YP_155625.1| Sec-independent prote")
        self.assertEqual(alignment.length, 72)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[75]
        self.assertEqual(alignment.title[:50], "gi|68214708|ref|ZP_00566522.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 72)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[76]
        self.assertEqual(alignment.title[:50], "gi|30248650|ref|NP_840720.1| mttA/Hcf106 family [N")
        self.assertEqual(alignment.length, 76)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[77]
        self.assertEqual(alignment.title[:50], "gi|75822907|ref|ZP_00752458.1| COG1826: Sec-indepe")
        self.assertEqual(alignment.length, 78)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[78]
        self.assertEqual(alignment.title[:50], "gi|70733926|ref|YP_257566.1| sec-independent prote")
        self.assertEqual(alignment.length, 93)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[79]
        self.assertEqual(alignment.title[:50], "gi|63254358|gb|AAY35454.1| Twin-arginine transloca")
        self.assertEqual(alignment.length, 91)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[80]
        self.assertEqual(alignment.title[:50], "gi|73354814|gb|AAZ75668.1| TatA [Pseudomonas syrin")
        self.assertEqual(alignment.length, 91)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[81]
        self.assertEqual(alignment.title[:50], "gi|50083761|ref|YP_045271.1| Sec-independent prote")
        self.assertEqual(alignment.length, 78)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[82]
        self.assertEqual(alignment.title[:50], "gi|71548504|ref|ZP_00668728.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 77)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[83]
        self.assertEqual(alignment.title[:50], "gi|55247002|gb|EAL42253.1| ENSANGP00000028218 [Ano")
        self.assertEqual(alignment.length, 53)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[84]
        self.assertEqual(alignment.title[:50], "gi|50084688|ref|YP_046198.1| Sec-independent prote")
        self.assertEqual(alignment.length, 71)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[85]
        self.assertEqual(alignment.title[:50], "gi|28872267|ref|NP_794886.1| sec-independent prote")
        self.assertEqual(alignment.length, 91)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[86]
        self.assertEqual(alignment.title[:50], "gi|49082486|gb|AAT50643.1| PA5068 [synthetic const")
        self.assertEqual(alignment.length, 83)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[87]
        self.assertEqual(alignment.title[:50], "gi|53726598|ref|ZP_00141543.2| COG1826: Sec-indepe")
        self.assertEqual(alignment.length, 82)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[88]
        self.assertEqual(alignment.title[:50], "gi|68213616|ref|ZP_00565447.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 54)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[89]
        self.assertEqual(alignment.title[:50], "gi|74023810|ref|ZP_00694377.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 79)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[90]
        self.assertEqual(alignment.title[:50], "gi|71066554|ref|YP_265281.1| twin-arginine translo")
        self.assertEqual(alignment.length, 87)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[91]
        self.assertEqual(alignment.title[:50], "gi|15611372|ref|NP_223023.1| hypothetical protein ")
        self.assertEqual(alignment.length, 79)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[92]
        self.assertEqual(alignment.title[:50], "gi|13471183|ref|NP_102752.1| sec-independent prote")
        self.assertEqual(alignment.length, 73)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[93]
        self.assertEqual(alignment.title[:50], "gi|42523995|ref|NP_969375.1| twin-arginine-depende")
        self.assertEqual(alignment.length, 81)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[94]
        self.assertEqual(alignment.title[:50], "gi|67158086|ref|ZP_00419176.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 85)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[95]
        self.assertEqual(alignment.title[:50], "gi|15644948|ref|NP_207118.1| conserved hypothetica")
        self.assertEqual(alignment.length, 79)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[96]
        self.assertEqual(alignment.title[:50], "gi|13277311|emb|CAC34414.1| putative TatA protein ")
        self.assertEqual(alignment.length, 61)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[97]
        self.assertEqual(alignment.title[:50], "gi|54298906|ref|YP_125275.1| Putative TatA protein")
        self.assertEqual(alignment.length, 61)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[98]
        self.assertEqual(alignment.title[:50], "gi|71363513|ref|ZP_00654157.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 94)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[99]
        self.assertEqual(alignment.title[:50], "gi|71362217|ref|ZP_00653377.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 80)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[100]
        self.assertEqual(alignment.title[:50], "gi|27379862|ref|NP_771391.1| hypothetical protein ")
        self.assertEqual(alignment.length, 77)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[101]
        self.assertEqual(alignment.title[:50], "gi|39935914|ref|NP_948190.1| putative sec-independ")
        self.assertEqual(alignment.length, 78)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[102]
        self.assertEqual(alignment.title[:50], "gi|17935600|ref|NP_532390.1| SEC-independent prote")
        self.assertEqual(alignment.length, 70)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[103]
        self.assertEqual(alignment.title[:50], "gi|62289827|ref|YP_221620.1| Sec-independent prote")
        self.assertEqual(alignment.length, 72)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[104]
        self.assertEqual(alignment.title[:50], "gi|23347697|gb|AAN29810.1| Sec-independent protein")
        self.assertEqual(alignment.length, 80)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[105]
        self.assertEqual(alignment.title[:50], "gi|75675971|ref|YP_318392.1| twin-arginine translo")
        self.assertEqual(alignment.length, 78)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[106]
        self.assertEqual(alignment.title[:50], "gi|69928230|ref|ZP_00625391.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 79)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[107]
        self.assertEqual(alignment.title[:50], "gi|77689454|ref|ZP_00804635.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 79)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[108]
        self.assertEqual(alignment.title[:50], "gi|77743614|ref|ZP_00812071.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 78)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[109]
        self.assertEqual(alignment.title[:50], "gi|71066141|ref|YP_264868.1| twin-arginine translo")
        self.assertEqual(alignment.length, 89)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[110]
        self.assertEqual(alignment.title[:50], "gi|28199457|ref|NP_779771.1| SEC-independent prote")
        self.assertEqual(alignment.length, 71)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[111]
        self.assertEqual(alignment.title[:50], "gi|15837166|ref|NP_297854.1| hypothetical protein ")
        self.assertEqual(alignment.length, 71)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[112]
        self.assertEqual(alignment.title[:50], "gi|15074462|emb|CAC46108.1| HYPOTHETICAL TRANSMEMB")
        self.assertEqual(alignment.length, 68)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[113]
        self.assertEqual(alignment.title[:50], "gi|27462871|gb|AAO15625.1| Sec-independent protein")
        self.assertEqual(alignment.length, 63)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[114]
        self.assertEqual(alignment.title[:50], "gi|35211273|dbj|BAC88652.1| gsl0711 [Gloeobacter v")
        self.assertEqual(alignment.length, 72)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[115]
        self.assertEqual(alignment.title[:50], "gi|34482347|emb|CAE09348.1| hypothetical protein [")
        self.assertEqual(alignment.length, 80)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[116]
        self.assertEqual(alignment.title[:50], "gi|32262257|gb|AAP77305.1| component of Sec-indepe")
        self.assertEqual(alignment.length, 82)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[117]
        self.assertEqual(alignment.title[:50], "gi|76261408|ref|ZP_00769019.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 62)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[118]
        self.assertEqual(alignment.title[:50], "gi|69933726|ref|ZP_00628928.1| sec-independent tra")
        self.assertEqual(alignment.length, 159)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[119]
        self.assertEqual(alignment.title[:50], "gi|15605662|ref|NP_213037.1| hypothetical protein ")
        self.assertEqual(alignment.length, 59)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[120]
        self.assertEqual(alignment.title[:50], "gi|68538777|ref|ZP_00578553.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 77)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[121]
        self.assertEqual(alignment.title[:50], "gi|68136098|ref|ZP_00544086.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 130)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[122]
        self.assertEqual(alignment.title[:50], "gi|20259265|gb|AAM14368.1| putative Tha4 protein [")
        self.assertEqual(alignment.length, 147)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[123]
        self.assertEqual(alignment.title[:50], "gi|75910646|ref|YP_324942.1| Twin-arginine translo")
        self.assertEqual(alignment.length, 90)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[124]
        self.assertEqual(alignment.title[:50], "gi|39982657|gb|AAR34117.1| twin-arginine transloca")
        self.assertEqual(alignment.length, 57)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[125]
        self.assertEqual(alignment.title[:50], "gi|33635687|emb|CAE22011.1| mttA/Hcf106 family [Pr")
        self.assertEqual(alignment.length, 91)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[126]
        self.assertEqual(alignment.title[:50], "gi|76791934|ref|ZP_00774438.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 68)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[127]
        self.assertEqual(alignment.title[:50], "gi|23129516|ref|ZP_00111343.1| COG1826: Sec-indepe")
        self.assertEqual(alignment.length, 91)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[128]
        self.assertEqual(alignment.title[:50], "gi|48764199|ref|ZP_00268751.1| COG1826: Sec-indepe")
        self.assertEqual(alignment.length, 96)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[129]
        self.assertEqual(alignment.title[:50], "gi|15677995|ref|NP_273645.1| hypothetical protein ")
        self.assertEqual(alignment.length, 67)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[130]
        self.assertEqual(alignment.title[:50], "gi|50917153|ref|XP_468973.1| putative sec-independ")
        self.assertEqual(alignment.length, 170)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[131]
        self.assertEqual(alignment.title[:50], "gi|16329622|ref|NP_440350.1| hypothetical protein ")
        self.assertEqual(alignment.length, 126)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[132]
        self.assertEqual(alignment.title[:50], "gi|71083667|ref|YP_266387.1| Twin-arginine translo")
        self.assertEqual(alignment.length, 66)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[133]
        self.assertEqual(alignment.title[:50], "gi|17130190|dbj|BAB72802.1| asl0845 [Nostoc sp. PC")
        self.assertEqual(alignment.length, 90)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[134]
        self.assertEqual(alignment.title[:50], "gi|68246031|gb|EAN28138.1| Twin-arginine transloca")
        self.assertEqual(alignment.length, 69)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[135]
        self.assertEqual(alignment.title[:50], "gi|15604583|ref|NP_221101.1| hypothetical protein ")
        self.assertEqual(alignment.length, 54)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[136]
        self.assertEqual(alignment.title[:50], "gi|77685166|ref|ZP_00800574.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 69)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[137]
        self.assertEqual(alignment.title[:50], "gi|39985226|gb|AAR36581.1| twin-arginine transloca")
        self.assertEqual(alignment.length, 78)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[138]
        self.assertEqual(alignment.title[:50], "gi|1825636|gb|AAB42258.1| Hypothetical protein ZK3")
        self.assertEqual(alignment.length, 312)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[139]
        self.assertEqual(alignment.title[:50], "gi|65321915|ref|ZP_00394874.1| COG5386: Cell surfa")
        self.assertEqual(alignment.length, 237)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[140]
        self.assertEqual(alignment.title[:50], "gi|30022625|ref|NP_834256.1| Cell surface protein ")
        self.assertEqual(alignment.length, 237)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[141]
        self.assertEqual(alignment.title[:50], "gi|55623442|ref|XP_517520.1| PREDICTED: similar to")
        self.assertEqual(alignment.length, 234)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[142]
        self.assertEqual(alignment.title[:50], "gi|75762866|ref|ZP_00742681.1| Cell surface protei")
        self.assertEqual(alignment.length, 237)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[143]
        self.assertEqual(alignment.title[:50], "gi|22945598|gb|AAN10511.1| CG18497-PC, isoform C [")
        self.assertEqual(alignment.length, 5476)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[144]
        self.assertEqual(alignment.title[:50], "gi|10727420|gb|AAF51534.2| CG18497-PB, isoform B [")
        self.assertEqual(alignment.length, 5533)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[145]
        self.assertEqual(alignment.title[:50], "gi|10727421|gb|AAF51535.2| CG18497-PA, isoform A [")
        self.assertEqual(alignment.length, 5560)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[146]
        self.assertEqual(alignment.title[:50], "gi|71481981|ref|ZP_00661682.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 69)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[147]
        self.assertEqual(alignment.title[:50], "gi|71150623|ref|ZP_00649545.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 81)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[148]
        self.assertEqual(alignment.title[:50], "gi|20151563|gb|AAM11141.1| LD15253p [Drosophila me")
        self.assertEqual(alignment.length, 1521)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[149]
        self.assertEqual(alignment.title[:50], "gi|6979936|gb|AAF34661.1| split ends long isoform ")
        self.assertEqual(alignment.length, 5554)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[150]
        self.assertEqual(alignment.title[:50], "gi|6467825|gb|AAF13218.1| Spen RNP motif protein l")
        self.assertEqual(alignment.length, 5533)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[151]
        self.assertEqual(alignment.title[:50], "gi|61102013|ref|ZP_00377467.1| hypothetical protei")
        self.assertEqual(alignment.length, 80)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[152]
        self.assertEqual(alignment.title[:50], "gi|68056232|ref|ZP_00540361.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 68)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[153]
        self.assertEqual(alignment.title[:50], "gi|68190120|gb|EAN04781.1| Twin-arginine transloca")
        self.assertEqual(alignment.length, 71)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[154]
        self.assertEqual(alignment.title[:50], "gi|15605663|ref|NP_213038.1| hypothetical protein ")
        self.assertEqual(alignment.length, 77)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[155]
        self.assertEqual(alignment.title[:50], "gi|60493413|emb|CAH08199.1| aerotolerance-related ")
        self.assertEqual(alignment.length, 238)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[156]
        self.assertEqual(alignment.title[:50], "gi|50877510|emb|CAG37350.1| related to Sec-indepen")
        self.assertEqual(alignment.length, 84)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[157]
        self.assertEqual(alignment.title[:50], "gi|42739647|gb|AAS43573.1| conserved domain protei")
        self.assertEqual(alignment.length, 236)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[158]
        self.assertEqual(alignment.title[:50], "gi|53713708|ref|YP_099700.1| conserved hypothetica")
        self.assertEqual(alignment.length, 238)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[159]
        self.assertEqual(alignment.title[:50], "gi|33860901|ref|NP_892462.1| mttA/Hcf106 family [P")
        self.assertEqual(alignment.length, 96)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[160]
        self.assertEqual(alignment.title[:50], "gi|48851224|ref|ZP_00305466.1| COG1826: Sec-indepe")
        self.assertEqual(alignment.length, 83)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[161]
        self.assertEqual(alignment.title[:50], "gi|67938449|ref|ZP_00530974.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 69)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[162]
        self.assertEqual(alignment.title[:50], "gi|45657833|ref|YP_001919.1| sec-independent prote")
        self.assertEqual(alignment.length, 90)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[163]
        self.assertEqual(alignment.title[:50], "gi|57238048|ref|YP_179297.1| twin-arginine translo")
        self.assertEqual(alignment.length, 79)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[164]
        self.assertEqual(alignment.title[:50], "gi|56962648|ref|YP_174374.1| sec-independent prote")
        self.assertEqual(alignment.length, 63)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[165]
        self.assertEqual(alignment.title[:50], "gi|33239734|ref|NP_874676.1| Sec-independent prote")
        self.assertEqual(alignment.length, 84)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[166]
        self.assertEqual(alignment.title[:50], "gi|21674434|ref|NP_662499.1| Sec-independent prote")
        self.assertEqual(alignment.length, 67)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[167]
        self.assertEqual(alignment.title[:50], "gi|39968009|ref|XP_365395.1| hypothetical protein ")
        self.assertEqual(alignment.length, 823)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[168]
        self.assertEqual(alignment.title[:50], "gi|4877986|gb|AAD31523.1| THA9 [Zea mays]")
        self.assertEqual(alignment.length, 169)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[169]
        self.assertEqual(alignment.title[:50], "gi|67934419|ref|ZP_00527476.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 56)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[170]
        self.assertEqual(alignment.title[:50], "gi|42523658|ref|NP_969038.1| twin-argine protein t")
        self.assertEqual(alignment.length, 79)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[171]
        self.assertEqual(alignment.title[:50], "gi|71546080|ref|ZP_00666945.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 73)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[172]
        self.assertEqual(alignment.title[:50], "gi|68002197|ref|ZP_00534828.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 60)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[173]
        self.assertEqual(alignment.title[:50], "gi|67481641|ref|XP_656170.1| hypothetical protein ")
        self.assertEqual(alignment.length, 434)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[174]
        self.assertEqual(alignment.title[:50], "gi|50935447|ref|XP_477251.1| putative Calreticulin")
        self.assertEqual(alignment.length, 424)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[175]
        self.assertEqual(alignment.title[:50], "gi|50978634|ref|NP_001003013.1| acidic (leucine-ri")
        self.assertEqual(alignment.length, 249)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[176]
        self.assertEqual(alignment.title[:50], "gi|70936814|ref|XP_739300.1| 40S ribosomal subunit")
        self.assertEqual(alignment.length, 184)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[177]
        self.assertEqual(alignment.title[:50], "gi|68075857|ref|XP_679848.1| hypothetical protein ")
        self.assertEqual(alignment.length, 340)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[178]
        self.assertEqual(alignment.title[:50], "gi|39594005|emb|CAE70115.1| Hypothetical protein C")
        self.assertEqual(alignment.length, 192)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[179]
        self.assertEqual(alignment.title[:50], "gi|66809957|ref|XP_638702.1| hypothetical protein ")
        self.assertEqual(alignment.length, 721)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[180]
        self.assertEqual(alignment.title[:50], "gi|68550463|ref|ZP_00589911.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 69)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[181]
        self.assertEqual(alignment.title[:50], "gi|51473916|ref|YP_067673.1| TatA/E-like Sec-indep")
        self.assertEqual(alignment.length, 53)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[182]
        self.assertEqual(alignment.title[:50], "gi|61857708|ref|XP_612559.1| PREDICTED: similar to")
        self.assertEqual(alignment.length, 236)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[183]
        self.assertEqual(alignment.title[:50], "gi|39982651|gb|AAR34111.1| twin-arginine transloca")
        self.assertEqual(alignment.length, 59)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[184]
        self.assertEqual(alignment.title[:50], "gi|50877509|emb|CAG37349.1| related to Sec-indepen")
        self.assertEqual(alignment.length, 66)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[185]
        self.assertEqual(alignment.title[:50], "gi|52699323|ref|ZP_00340731.1| COG1826: Sec-indepe")
        self.assertEqual(alignment.length, 53)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[186]
        self.assertEqual(alignment.title[:50], "gi|62426215|ref|ZP_00381343.1| COG1826: Sec-indepe")
        self.assertEqual(alignment.length, 93)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[187]
        self.assertEqual(alignment.title[:50], "gi|11131838|sp|Q9SLY8|CRTC_ORYSA Calreticulin prec")
        self.assertEqual(alignment.length, 424)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[188]
        self.assertEqual(alignment.title[:50], "gi|56543690|gb|AAV89844.1| Sec-independent protein")
        self.assertEqual(alignment.length, 87)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[189]
        self.assertEqual(alignment.title[:50], "gi|67923730|ref|ZP_00517196.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 95)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[190]
        self.assertEqual(alignment.title[:50], "gi|67462585|ref|XP_647954.1| hypothetical protein ")
        self.assertEqual(alignment.length, 140)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[191]
        self.assertEqual(alignment.title[:50], "gi|51970620|dbj|BAD44002.1| unknown protein [Arabi")
        self.assertEqual(alignment.length, 784)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[192]
        self.assertEqual(alignment.title[:50], "gi|34581241|ref|ZP_00142721.1| hypothetical protei")
        self.assertEqual(alignment.length, 53)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[193]
        self.assertEqual(alignment.title[:50], "gi|4877984|gb|AAD31522.1| THA4 [Zea mays]")
        self.assertEqual(alignment.length, 170)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[194]
        self.assertEqual(alignment.title[:50], "gi|9757886|dbj|BAB08393.1| unnamed protein product")
        self.assertEqual(alignment.length, 707)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[195]
        self.assertEqual(alignment.title[:50], "gi|32422107|ref|XP_331497.1| predicted protein [Ne")
        self.assertEqual(alignment.length, 216)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[196]
        self.assertEqual(alignment.title[:50], "gi|68552035|ref|ZP_00591428.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 70)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[197]
        self.assertEqual(alignment.title[:50], "gi|68177649|ref|ZP_00550794.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 58)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[198]
        self.assertEqual(alignment.title[:50], "gi|67934756|ref|ZP_00527782.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 65)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[199]
        self.assertEqual(alignment.title[:50], "gi|42550455|gb|EAA73298.1| hypothetical protein FG")
        self.assertEqual(alignment.length, 297)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[200]
        self.assertEqual(alignment.title[:50], "gi|15893083|ref|NP_360797.1| hypothetical protein ")
        self.assertEqual(alignment.length, 53)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[201]
        self.assertEqual(alignment.title[:50], "gi|57233621|ref|YP_182297.1| twin-arginine translo")
        self.assertEqual(alignment.length, 65)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[202]
        self.assertEqual(alignment.title[:50], "gi|75908036|ref|YP_322332.1| Twin-arginine translo")
        self.assertEqual(alignment.length, 56)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[203]
        self.assertEqual(alignment.title[:50], "gi|72383453|ref|YP_292808.1| Twin-arginine translo")
        self.assertEqual(alignment.length, 71)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[204]
        self.assertEqual(alignment.title[:50], "gi|1666185|emb|CAB04766.1| ORF13(1) [Rhodococcus e")
        self.assertEqual(alignment.length, 98)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[205]
        self.assertEqual(alignment.title[:50], "gi|72138252|ref|XP_800288.1| PREDICTED: hypothetic")
        self.assertEqual(alignment.length, 946)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[206]
        self.assertEqual(alignment.title[:50], "gi|67923190|ref|ZP_00516678.1| Twin-arginine trans")
        self.assertEqual(alignment.length, 50)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[207]
        self.assertEqual(alignment.title[:50], "gi|3329623|gb|AAC26930.1| Hypothetical protein F36")
        self.assertEqual(alignment.length, 335)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[208]
        self.assertEqual(alignment.title[:50], "gi|39597929|emb|CAE68621.1| Hypothetical protein C")
        self.assertEqual(alignment.length, 2691)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[209]
        self.assertEqual(alignment.title[:50], "gi|68182025|ref|ZP_00555006.1| hypothetical protei")
        self.assertEqual(alignment.length, 438)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[210]
        self.assertEqual(alignment.title[:50], "gi|21204492|dbj|BAB95189.1| ebh [Staphylococcus au")
        self.assertEqual(alignment.length, 9904)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        alignment = alignments[211]
        self.assertEqual(alignment.title[:50], "gi|39593039|emb|CAE64508.1| Hypothetical protein C")
        self.assertEqual(alignment.length, 960)
        self.assertEqual(len(alignment.hsps), 1)
        self.assert_(alignment.hsps[0].expect > E_VALUE_THRESH)

        self.assertRaises(StopIteration, records.next)
        record = NCBIXML.read(open(datafile))

    def test_xbt002(self):
        "Parsing BLASTN 2.2.12, gi|1348916|gb|G26684.1|G26684"

        filename = 'xbt002.xml'
        datafile = os.path.join("Blast", filename)
        records = NCBIXML.parse(open(datafile))
        record = records.next()
        alignments = record.alignments

        self.assertEqual(record.query_id, "gi|1348916|gb|G26684.1|G26684")
        self.assertEqual(len(alignments), 2)
        self.assertEqual(sum([len(a.hsps) for a in alignments]), 2)
        self.assertEqual(alignments[0].title[:50], "gi|9950606|gb|AE004854.1| Pseudomonas aeruginosa P")
        self.assertEqual(alignments[0].length, 11884)
        self.assertEqual(len(alignments[0].hsps), 1)
        self.assert_(alignments[0].hsps[0].expect > E_VALUE_THRESH)
        self.assertEqual(alignments[1].title[:50], "gi|15073988|emb|AL591786.1|SME591786 Sinorhizobium")
        self.assertEqual(alignments[1].length, 299350)
        self.assertEqual(len(alignments[1].hsps), 1)
        self.assert_(alignments[1].hsps[0].expect > E_VALUE_THRESH)

        self.assertRaises(StopIteration, records.next)
        record = NCBIXML.read(open(datafile))

    def test_xbt003(self):
        "Parsing BLASTX 2.2.12, gi|1347369|gb|G25137.1|G25137"

        filename = 'xbt003.xml'
        datafile = os.path.join("Blast", filename)
        records = NCBIXML.parse(open(datafile))
        record = records.next()
        alignments = record.alignments
        self.assertEqual(record.query_id, "gi|1347369|gb|G25137.1|G25137")
        self.assertEqual(len(alignments), 78)
        self.assertEqual(sum([len(a.hsps) for a in alignments]), 84)

        self.assertRaises(StopIteration, records.next)
        record = NCBIXML.read(open(datafile))

    def test_xbt004(self):
        "Parsing TBLASTN 2.2.12, gi|729325|sp|P39483|DHG2_BACME"

        filename = 'xbt004.xml'
        datafile = os.path.join("Blast", filename)
        records = NCBIXML.parse(open(datafile))
        record = records.next()
        alignments = record.alignments
        self.assertEqual(record.query_id, "gi|729325|sp|P39483|DHG2_BACME")
        self.assertEqual(len(alignments), 100)
        self.assertEqual(sum([len(a.hsps) for a in alignments]), 127)

        self.assertRaises(StopIteration, records.next)
        record = NCBIXML.read(open(datafile))

    def test_xbt005(self):
        "Parsing TBLASTX 2.2.12, gi|1348853|gb|G26621.1|G26621, BLOSUM80"

        filename = 'xbt005.xml'
        datafile = os.path.join("Blast", filename)
        records = NCBIXML.parse(open(datafile))
        record = records.next()
        alignments = record.alignments
        self.assertEqual(record.query_id, "gi|1348853|gb|G26621.1|G26621")
        self.assertEqual(len(alignments), 10)
        self.assertEqual(sum([len(a.hsps) for a in alignments]), 102)

        self.assertRaises(StopIteration, records.next)
        record = NCBIXML.read(open(datafile))

    def test_xbt006(self):
        "Parsing BLASTP 2.2.18+, gi|160837788|ref|NP_075631.2|"
        # NOTE - no date in version field, downloaded 2008/05/08

        filename = 'xbt006.xml'
        datafile = os.path.join("Blast", filename)
        records = NCBIXML.parse(open(datafile))

        record = records.next()
        alignments = record.alignments
        self.assertEqual(record.query_id, "31493")
        self.assertEqual(len(alignments), 10)
        self.assertEqual(sum([len(a.hsps) for a in alignments]), 14)
        self.assertEqual(alignments[0].title[:50], "gi|151942244|gb|EDN60600.1| cytosolic iron-sulfur ")
        self.assertEqual(alignments[0].length, 330)
        self.assertEqual(len(alignments[0].hsps), 1)
        self.assert_(alignments[0].hsps[0].expect > E_VALUE_THRESH)
        self.assertEqual(alignments[1].title[:50], "gi|476059|emb|CAA55606.1| YBR0832 [Saccharomyces c")
        self.assertEqual(alignments[1].length, 535)
        self.assertEqual(len(alignments[1].hsps), 1)
        self.assert_(alignments[1].hsps[0].expect > E_VALUE_THRESH)
        self.assertEqual(alignments[2].title[:50], "gi|6320473|ref|NP_010553.1| Essential protein invo")
        self.assertEqual(alignments[2].length, 330)
        self.assertEqual(len(alignments[2].hsps), 1)
        self.assert_(alignments[2].hsps[0].expect > E_VALUE_THRESH)
        self.assertEqual(alignments[3].title[:50], "gi|61679798|pdb|1R5M|A Chain A, Crystal Structure ")
        self.assertEqual(alignments[3].length, 425)
        self.assertEqual(len(alignments[3].hsps), 1)
        self.assert_(alignments[3].hsps[0].expect > E_VALUE_THRESH)
        self.assertEqual(alignments[4].title[:50], "gi|6319579|ref|NP_009661.1| WD40 repeat-containing")
        self.assertEqual(alignments[4].length, 535)
        self.assertEqual(len(alignments[4].hsps), 1)
        self.assert_(alignments[4].hsps[0].expect > E_VALUE_THRESH)
        self.assertEqual(alignments[5].title[:50], "gi|151946495|gb|EDN64717.1| Sir4p-interacting fact")
        self.assertEqual(alignments[5].length, 535)
        self.assertEqual(len(alignments[5].hsps), 1)
        self.assert_(alignments[5].hsps[0].expect > E_VALUE_THRESH)
        self.assertEqual(alignments[6].title[:50], "gi|151943708|gb|EDN62018.1| nuclear pore complex s")
        self.assertEqual(alignments[6].length, 349)
        self.assertEqual(len(alignments[6].hsps), 2)
        self.assert_(alignments[6].hsps[0].expect > E_VALUE_THRESH)
        self.assert_(alignments[6].hsps[1].expect > E_VALUE_THRESH)
        self.assertEqual(alignments[7].title[:50], "gi|151567866|pdb|2PM7|B Chain B, Crystal Structure")
        self.assertEqual(alignments[7].length, 297)
        self.assertEqual(len(alignments[7].hsps), 2)
        self.assert_(alignments[7].hsps[0].expect > E_VALUE_THRESH)
        self.assert_(alignments[7].hsps[1].expect > E_VALUE_THRESH)
        self.assertEqual(alignments[8].title[:50], "gi|6321338|ref|NP_011415.1| Nuclear pore protein t")
        self.assertEqual(alignments[8].length, 349)
        self.assertEqual(len(alignments[8].hsps), 2)
        self.assert_(alignments[8].hsps[0].expect > E_VALUE_THRESH)
        self.assert_(alignments[8].hsps[1].expect > E_VALUE_THRESH)
        self.assertEqual(alignments[9].title[:50], "gi|151567870|pdb|2PM9|B Chain B, Crystal Structure")
        self.assertEqual(alignments[9].length, 297)
        self.assertEqual(len(alignments[9].hsps), 2)
        self.assert_(alignments[9].hsps[0].expect > E_VALUE_THRESH)
        self.assert_(alignments[9].hsps[1].expect > E_VALUE_THRESH)

        self.assertRaises(StopIteration, records.next)
        record = NCBIXML.read(open(datafile))

    def test_xbt007(self):
        "Parsing BLASTP 2.2.18+, SwissProt Q08386 and P07175, no hits"

        filename = 'xbt007.xml'
        datafile = os.path.join("Blast", filename)
        records = NCBIXML.parse(open(datafile))
        record = records.next()
        self.assertEqual(record.query_id, "gi|585505|sp|Q08386|MOPB_RHOCA")
        alignments = record.alignments
        self.assertEqual(len(record.alignments), 0)
        record = records.next()
        self.assertEqual(record.query_id, "gi|129628|sp|P07175.1|PARA_AGRTU")
        self.assertEqual(len(record.alignments), 0)

        self.assertRaises(StopIteration, records.next)

    def test_blastp_no_hits(self):
        "Parsing BLASTP 2.2.18, Fake query"

        filename = 'blastp_no_hits.xml'
        datafile = os.path.join("Blast", filename)
        records = NCBIXML.parse(open(datafile))
        record = records.next()
        self.assertEqual(record.query_id, "lcl|1_0")
        alignments = record.alignments
        self.assertEqual(len(alignments), 0)
        self.assertRaises(StopIteration, records.next)
        record = NCBIXML.read(open(datafile))


if __name__ == "__main__" :
    runner = unittest.TextTestRunner(verbosity = 2)
    unittest.main(testRunner=runner)

Generated by  Doxygen 1.6.0   Back to index